General Information

  • ID:  hor006749
  • Uniprot ID:  P82934(2-87)
  • Protein name:  Acyl-CoA-binding protein
  • Gene name:  DBI
  • Organism:  Chaetophractus villosus (South American armadillo)
  • Family:  ACBP family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:   Chaetophractus (genus), Chlamyphoridae (family), Cingulata (order), Xenarthra (superorder), Eutheria , Theria , Mammalia (class), Amniota , Tetrapoda , Dipnotetrapodomorpha , Sarcopterygii (superclass), Euteleostomi , Teleostomi , Gnathostomata , Vertebrata , Craniata (subphylum), Chordata (phylum), Deuterostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
  • GO MF:  GO:0000062 fatty-acyl-CoA binding; GO:0008289 lipid binding
  • GO BP:  NA
  • GO CC:  GO:0005783 endoplasmic reticulum; GO:0005794 Golgi apparatus

Sequence Information

  • Sequence:  SQAEFDKAAEEVKNLKTKPADDEMLFIYSHYKQATVGDINTERPGMLDFKGKAKWDAWNQLKGTSKEDAMKSYIDKVEELKKKYGI
  • Length:  86(2-87)
  • Propeptide:  MSQAEFDKAAEEVKNLKTKPADDEMLFIYSHYKQATVGDINTERPGMLDFKGKAKWDAWNQLKGTSKEDAMKSYIDKVEELKKKYGI
  • Signal peptide:  NA
  • Modification:  T1 N-acetylserine;T7 N6-acetyllysine;T7 N6-succinyllysine;T16 N6-succinyllysine;T18 N6-acetyllysine;T28 Phosphotyrosine;T50 N6-acetyllysine;T54 N6-(2-hydroxyisobutyryl)lysine;T54 N6-acetyllysine;T54 N6-malonyllysine;T54 N6-succinyllysine;T76 N6-acetyllysi
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Binds medium- and long-chain acyl-CoA esters with very high affinity and may function as an intracellular carrier of acyl-CoA esters.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P82934-F1(AlphaFold_DB_ID)/2FDQ(PDB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    2fdq.pdbhor006749_AF2.pdbhor006749_ESM.pdb

Physical Information

Mass: 1140756 Formula: C442H692N114O137S3
Absent amino acids: C Common amino acids: K
pI: 7.52 Basic residues: 17
Polar residues: 20 Hydrophobic residues: 25
Hydrophobicity: -96.86 Boman Index: -19182
Half-Life: 1.9 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 60.23
Instability Index: 1987.44 Extinction Coefficient cystines: 16960
Absorbance 280nm: 199.53

Literature

  • PubMed ID:  11342056
  • Title:  Acyl-CoA-binding protein in the armadillo Harderian gland: its primary structure and possible role in lipid secretion.
  • PubMed ID:  17012783
  • Title:  Structure of armadillo ACBP: a new member of the acyl-CoA-binding protein family.